Lineage for d1tcoc_ (1tco C:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255712Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 255713Superfamily d.26.1: FKBP-like [54534] (2 families) (S)
  5. 255714Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (11 proteins)
  6. 255715Protein Calcineurin (FKBP12.6) [54539] (3 species)
  7. 255718Species Cow (Bos taurus) [TaxId:9913] [54541] (1 PDB entry)
  8. 255719Domain d1tcoc_: 1tco C: [38426]
    Other proteins in same PDB: d1tcoa_, d1tcob_
    complexed with ca, fe, fk5, myr, po4, zn

Details for d1tcoc_

PDB Entry: 1tco (more details), 2.5 Å

PDB Description: ternary complex of a calcineurin a fragment, calcineurin b, fkbp12 and the immunosuppressant drug fk506 (tacrolimus)

SCOP Domain Sequences for d1tcoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tcoc_ d.26.1.1 (C:) Calcineurin (FKBP12.6) {Cow (Bos taurus)}
gvqvetispgdgrtfpkagqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

SCOP Domain Coordinates for d1tcoc_:

Click to download the PDB-style file with coordinates for d1tcoc_.
(The format of our PDB-style files is described here.)

Timeline for d1tcoc_: