SCOPe 2.02: Domain d1qplc_: 1qpl C:

Lineage for d1qplc_ (1qpl C:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)

6. Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
   cis-trans prolyl-isomerase

7. Species Human (Homo sapiens) [TaxId:9606] [54537] (41 PDB entries)

8. Domain d1qplc_: 1qpl C: [38418]
   complexed with 587

Details for d1qplc_

PDB Entry: 1qpl, 2.9 Å

PDB Description: fk506 binding protein (12 kda, human) complex with l-707,587

PDB Compounds: (C:) protein (fk506-binding protein)

SCOPe Domain Sequences for d1qplc_:

Sequence; same for both SEQRES and ATOM records:

>d1qplc_ d.26.1.1 (C:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

Timeline for d1qplc_:

• d1qplc_ first appeared (with stable ids) in SCOP 1.55
  
• d1qplc_ appears in SCOPe 2.01
  
• d1qplc_ appears in SCOPe 2.03
  
• d1qplc_ appears in the current release, SCOPe 2.08