PDB entry 1qpl
View 1qpl on RCSB PDB site
Description: fk506 binding protein (12 kda, human) complex with l-707,587
Class: isomerase
Keywords: immunophilin-drug complex, cis-trans isomerase, peptidyl-prolyl isomerase
Deposited on
1999-05-25, released
1999-08-16
The last revision prior to the SCOPe 2.02 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.223
AEROSPACI score: 0.23
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protein (fk506-binding protein)
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1qpla_ - Chain 'C':
Compound: protein (fk506-binding protein)
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1qplc_ - Heterogens: 587, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1qplA (A:)
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1qplC (C:)
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle