SCOPe 2.07: Domain d6kbfa1: 6kbf A:79-228

Lineage for d6kbfa1 (6kbf A:79-228)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (50 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:5843] [354073] (9 PDB entries)

8. Domain d6kbfa1: 6kbf A:79-228 [383373]
   Other proteins in same PDB: d6kbfa2, d6kbfb2
   automated match to d3bjua1
   protein/RNA complex; complexed with d4x, dms, gol, lys

Details for d6kbfa1

PDB Entry: 6kbf, 1.92 Å

PDB Description: crystal structure of plasmodium lysyl-trna synthetase in complex with a cladosporin derivative 3

PDB Compounds: (A:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6kbfa1:

Sequence; same for both SEQRES and ATOM records:

>d6kbfa1 b.40.4.0 (A:79-228) automated matches {Plasmodium falciparum [TaxId: 5843]}
dprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitgr
imrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgk
skkgelsifpketillsaclhmlpmkyglk

Timeline for d6kbfa1:

• d6kbfa1 is new in SCOPe 2.07-stable
  
• d6kbfa1 appears in the current release, SCOPe 2.08