Lineage for d3bjua1 (3bju A:70-221)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2400006Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2400007Protein automated matches [190576] (50 species)
    not a true protein
  7. 2400092Species Human (Homo sapiens) [TaxId:9606] [225402] (14 PDB entries)
  8. 2400105Domain d3bjua1: 3bju A:70-221 [208647]
    Other proteins in same PDB: d3bjua2, d3bjub2, d3bjuc2, d3bjud2
    automated match to d1bbua1
    complexed with atp, ca, lys

Details for d3bjua1

PDB Entry: 3bju (more details), 2.31 Å

PDB Description: crystal structure of tetrameric form of human lysyl-trna synthetase
PDB Compounds: (A:) lysyl-tRNA synthetase

SCOPe Domain Sequences for d3bjua1:

Sequence, based on SEQRES records: (download)

>d3bjua1 b.40.4.0 (A:70-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svdpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkva
grihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpg
ktkkgelsiipyeitllspclhmlphlhfglk

Sequence, based on observed residues (ATOM records): (download)

>d3bjua1 b.40.4.0 (A:70-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svdpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkva
grihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpg
ktkkgelsiipyeitllspclhmlphlk

SCOPe Domain Coordinates for d3bjua1:

Click to download the PDB-style file with coordinates for d3bjua1.
(The format of our PDB-style files is described here.)

Timeline for d3bjua1: