SCOPe 2.08: Domain d6m1ta1: 6m1t A:1-80

Lineage for d6m1ta1 (6m1t A:1-80)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Sphingobium chungbukense [TaxId:56193] [383332] (1 PDB entry)

8. Domain d6m1ta1: 6m1t A:1-80 [383333]
   Other proteins in same PDB: d6m1ta2, d6m1tb2
   automated match to d3uara1
   complexed with 1pe, cys, gsh, so4

Details for d6m1ta1

PDB Entry: 6m1t, 1.9 Å

PDB Description: bacterial beta class sphingomonas chungbukensis glutathione s- transferase

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d6m1ta1:

Sequence; same for both SEQRES and ATOM records:

>d6m1ta1 c.47.1.0 (A:1-80) automated matches {Sphingobium chungbukense [TaxId: 56193]}
mklfispgacslaphialretgaafdavkvdlatrkvetgddfltvnpsgkvpaltldsg
etltenpaillyiadqkpda

Timeline for d6m1ta1:

• d6m1ta1 first appeared in SCOPe 2.07