Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Sphingobium chungbukense [TaxId:56193] [383332] (1 PDB entry) |
Domain d6m1ta1: 6m1t A:1-80 [383333] Other proteins in same PDB: d6m1ta2, d6m1tb2 automated match to d3uara1 complexed with 1pe, cys, gsh, so4 |
PDB Entry: 6m1t (more details), 1.9 Å
SCOPe Domain Sequences for d6m1ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6m1ta1 c.47.1.0 (A:1-80) automated matches {Sphingobium chungbukense [TaxId: 56193]} mklfispgacslaphialretgaafdavkvdlatrkvetgddfltvnpsgkvpaltldsg etltenpaillyiadqkpda
Timeline for d6m1ta1: