Lineage for d1ayzc_ (1ayz C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2938984Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2939009Species Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId:4932] [54499] (1 PDB entry)
  8. 2939012Domain d1ayzc_: 1ayz C: [38328]

Details for d1ayzc_

PDB Entry: 1ayz (more details), 2.6 Å

PDB Description: crystal structure of the saccharomyces cerevisiae ubiquitin-conjugating enzyme rad6 (ubc2) at 2.6a resolution
PDB Compounds: (C:) ubiquitin-conjugating enzyme rad6

SCOPe Domain Sequences for d1ayzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ayzc_ d.20.1.1 (C:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]}
stparrrlmrdfkrmkedappgvsasplpdnvmvwnamiigpadtpyedgtfrlllefde
eypnkpphvkflsemfhpnvyangeicldilqnrwtptydvasiltsiqslfndpnpasp
anveaatlfkdhksqyvkrvketveksweddmd

SCOPe Domain Coordinates for d1ayzc_:

Click to download the PDB-style file with coordinates for d1ayzc_.
(The format of our PDB-style files is described here.)

Timeline for d1ayzc_: