Lineage for d6r78a_ (6r78 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996833Protein automated matches [190079] (12 species)
    not a true protein
  7. 2996879Species Klebsiella pneumoniae [TaxId:573] [271524] (9 PDB entries)
  8. 2996892Domain d6r78a_: 6r78 A: [383116]
    automated match to d4ubqa_
    complexed with bme, edo, gol, na, peg, zn

Details for d6r78a_

PDB Entry: 6r78 (more details), 2.21 Å

PDB Description: structure of imp-13 metallo-beta-lactamase in apo form (loop closed)
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6r78a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6r78a_ d.157.1.1 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
lpdlkiekleegvfvhtsfeevngwgvvtkhglvvlvntdaylidtpftatdteklvnwf
vergyeikgtisshfhsdstggiewlnsqsiptyaseltnellkksgkvqakysfsevsy
wlvknkievfypgpghtqdnlvvwlpeskilfggcfikphglgnlgdanleawpksakil
mskygkaklvvsshsekgdaslmkrtweqalkglkesk

SCOPe Domain Coordinates for d6r78a_:

Click to download the PDB-style file with coordinates for d6r78a_.
(The format of our PDB-style files is described here.)

Timeline for d6r78a_: