![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) ![]() |
![]() | Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
![]() | Protein automated matches [190079] (12 species) not a true protein |
![]() | Species Acinetobacter baumannii [TaxId:470] [268954] (1 PDB entry) |
![]() | Domain d4ubqa_: 4ubq A: [268955] automated match to d4f6ha_ complexed with act, zn |
PDB Entry: 4ubq (more details), 2.3 Å
SCOPe Domain Sequences for d4ubqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ubqa_ d.157.1.1 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]} lpdlkiekleegvyvhtsfeevngwgvvskhglvvlvntdaylidtpftatdteklvnwf vergykikgtisshfhsdstggiewlnsqsiptyaseltnellkkdgkvqaknsfsgvsy wlvknkievfypgpghtqdnvvvwlpekkilfggcfvkpdglgnlgdanleawpksakil mskyvkaklvvsshseigdasllkrtweqavkglnesk
Timeline for d4ubqa_: