Lineage for d4ubqa_ (4ubq A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996833Protein automated matches [190079] (12 species)
    not a true protein
  7. 2996834Species Acinetobacter baumannii [TaxId:470] [268954] (1 PDB entry)
  8. 2996835Domain d4ubqa_: 4ubq A: [268955]
    automated match to d4f6ha_
    complexed with act, zn

Details for d4ubqa_

PDB Entry: 4ubq (more details), 2.3 Å

PDB Description: crystal structure of imp-2 metallo-beta-lactamase from acinetobacter spp.
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d4ubqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ubqa_ d.157.1.1 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
lpdlkiekleegvyvhtsfeevngwgvvskhglvvlvntdaylidtpftatdteklvnwf
vergykikgtisshfhsdstggiewlnsqsiptyaseltnellkkdgkvqaknsfsgvsy
wlvknkievfypgpghtqdnvvvwlpekkilfggcfvkpdglgnlgdanleawpksakil
mskyvkaklvvsshseigdasllkrtweqavkglnesk

SCOPe Domain Coordinates for d4ubqa_:

Click to download the PDB-style file with coordinates for d4ubqa_.
(The format of our PDB-style files is described here.)

Timeline for d4ubqa_: