Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries) |
Domain d6ocdd_: 6ocd D: [383030] Other proteins in same PDB: d6ocda_, d6ocdc_ automated match to d4ocmc_ complexed with cl, edo, imd, zn |
PDB Entry: 6ocd (more details), 2.1 Å
SCOPe Domain Sequences for d6ocdd_:
Sequence, based on SEQRES records: (download)
>d6ocdd_ b.1.1.1 (D:) automated matches {Vicugna pacos [TaxId: 30538]} lvetggglvqsggslrlscaasgftldnynigwfrqapgkeyggvscisssdgstyyads vkgrftisrdnakntvylqmnnlkpedtdvyycaatkygsscpirpydywgqgtqvtvss ah
>d6ocdd_ b.1.1.1 (D:) automated matches {Vicugna pacos [TaxId: 30538]} lvetggglvqsggslrlscaasgftldnynigwfrqapgkeyggvscisssdgstyyads vkgrftisrdnakntvylqmnnlkpedtdvyycaatkygsscpirpydywgqgtqvtvss h
Timeline for d6ocdd_: