Lineage for d1fg2d2 (1fg2 D:2-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2938003Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (29 PDB entries)
  8. 2938030Domain d1fg2d2: 1fg2 D:2-181 [38301]
    Other proteins in same PDB: d1fg2a1, d1fg2b_, d1fg2d1, d1fg2e_, d1fg2g1, d1fg2h_, d1fg2j1, d1fg2k_

Details for d1fg2d2

PDB Entry: 1fg2 (more details), 2.75 Å

PDB Description: crystal structure of the lcmv peptidic epitope gp33 in complex with the murine class i mhc molecule h-2db
PDB Compounds: (D:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d1fg2d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fg2d2 d.19.1.1 (D:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr

SCOPe Domain Coordinates for d1fg2d2:

Click to download the PDB-style file with coordinates for d1fg2d2.
(The format of our PDB-style files is described here.)

Timeline for d1fg2d2: