![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
![]() | Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (29 PDB entries) |
![]() | Domain d1fg2g2: 1fg2 G:2-181 [38302] Other proteins in same PDB: d1fg2a1, d1fg2b_, d1fg2d1, d1fg2e_, d1fg2g1, d1fg2h_, d1fg2j1, d1fg2k_ |
PDB Entry: 1fg2 (more details), 2.75 Å
SCOPe Domain Sequences for d1fg2g2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fg2g2 d.19.1.1 (G:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]} phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
Timeline for d1fg2g2: