SCOPe 2.08: Domain d6jqqa2: 6jqq A:598-753

Lineage for d6jqqa2 (6jqq A:598-753)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.0: automated matches [191336] (1 protein)
   not a true family

6. Protein automated matches [190197] (23 species)
   not a true protein

7. Species Escherichia coli [TaxId:1432555] [382946] (1 PDB entry)

8. Domain d6jqqa2: 6jqq A:598-753 [383002]
   Other proteins in same PDB: d6jqqa1, d6jqqb1, d6jqqc1, d6jqqd1
   automated match to d1p80a1
   complexed with edo, hem

Details for d6jqqa2

PDB Entry: 6jqq, 2.4 Å

PDB Description: kate h392c from escherichia coli

PDB Compounds: (A:) catalase

SCOPe Domain Sequences for d6jqqa2:

Sequence; same for both SEQRES and ATOM records:

>d6jqqa2 c.23.16.0 (A:598-753) automated matches {Escherichia coli [TaxId: 1432555]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikvadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

Timeline for d6jqqa2:

• d6jqqa2 first appeared in SCOPe 2.07