Lineage for d6jqqd2 (6jqq D:598-753)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2859252Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 2859253Protein automated matches [190197] (23 species)
    not a true protein
  7. 2859348Species Escherichia coli [TaxId:1432555] [382946] (1 PDB entry)
  8. 2859352Domain d6jqqd2: 6jqq D:598-753 [382947]
    Other proteins in same PDB: d6jqqa1, d6jqqb1, d6jqqc1, d6jqqd1
    automated match to d1p80a1
    complexed with edo, hem

Details for d6jqqd2

PDB Entry: 6jqq (more details), 2.4 Å

PDB Description: kate h392c from escherichia coli
PDB Compounds: (D:) catalase

SCOPe Domain Sequences for d6jqqd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jqqd2 c.23.16.0 (D:598-753) automated matches {Escherichia coli [TaxId: 1432555]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikvadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

SCOPe Domain Coordinates for d6jqqd2:

Click to download the PDB-style file with coordinates for d6jqqd2.
(The format of our PDB-style files is described here.)

Timeline for d6jqqd2: