SCOPe 2.07: Domain d6tdqc1: 6tdq C:1-181

Lineage for d6tdqc1 (6tdq C:1-181)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-A2 [TaxId:9606] [54469] (9 PDB entries)

8. Domain d6tdqc1: 6tdq C:1-181 [382874]
   Other proteins in same PDB: d6tdqa2, d6tdqb1, d6tdqb2, d6tdqc2, d6tdqd1, d6tdqd2
   automated match to d4l29a1
   complexed with cl, edo, gly, met

Details for d6tdqc1

PDB Entry: 6tdq, 1.6 Å

PDB Description: crystal structure of the disulfide engineered hla-a0201 molecule in complex with one gm dipeptide in the a pocket and one gm dipeptide in the f pocket.

PDB Compounds: (C:) MHC class I antigen

SCOPe Domain Sequences for d6tdqc1:

Sequence; same for both SEQRES and ATOM records:

>d6tdqc1 d.19.1.1 (C:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgcynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmcaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d6tdqc1:

• d6tdqc1 is new in SCOPe 2.07-stable
  
• d6tdqc1 appears in the current release, SCOPe 2.08