Lineage for d6tdqc1 (6tdq C:1-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544723Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2544738Species Human (Homo sapiens), HLA-A2 [TaxId:9606] [54469] (9 PDB entries)
  8. 2544742Domain d6tdqc1: 6tdq C:1-181 [382874]
    Other proteins in same PDB: d6tdqa2, d6tdqb1, d6tdqb2, d6tdqc2, d6tdqd1, d6tdqd2
    automated match to d4l29a1
    complexed with cl, edo, gly, met

Details for d6tdqc1

PDB Entry: 6tdq (more details), 1.6 Å

PDB Description: crystal structure of the disulfide engineered hla-a0201 molecule in complex with one gm dipeptide in the a pocket and one gm dipeptide in the f pocket.
PDB Compounds: (C:) MHC class I antigen

SCOPe Domain Sequences for d6tdqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tdqc1 d.19.1.1 (C:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgcynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmcaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d6tdqc1:

Click to download the PDB-style file with coordinates for d6tdqc1.
(The format of our PDB-style files is described here.)

Timeline for d6tdqc1: