Lineage for d6tdqa2 (6tdq A:182-275)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2365871Domain d6tdqa2: 6tdq A:182-275 [382839]
    Other proteins in same PDB: d6tdqa1, d6tdqb1, d6tdqb2, d6tdqc1, d6tdqd1, d6tdqd2
    automated match to d1ogaa1
    complexed with cl, edo, gly, met

Details for d6tdqa2

PDB Entry: 6tdq (more details), 1.6 Å

PDB Description: crystal structure of the disulfide engineered hla-a0201 molecule in complex with one gm dipeptide in the a pocket and one gm dipeptide in the f pocket.
PDB Compounds: (A:) MHC class I antigen

SCOPe Domain Sequences for d6tdqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tdqa2 b.1.1.0 (A:182-275) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwvavvvpsgqeqrytchvqheglpkpltlrwe

SCOPe Domain Coordinates for d6tdqa2:

Click to download the PDB-style file with coordinates for d6tdqa2.
(The format of our PDB-style files is described here.)

Timeline for d6tdqa2: