Lineage for d6tdsc1 (6tds C:1-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2937671Species Human (Homo sapiens), HLA-A2 [TaxId:9606] [54469] (9 PDB entries)
  8. 2937678Domain d6tdsc1: 6tds C:1-181 [382864]
    Other proteins in same PDB: d6tdsa2, d6tdsb1, d6tdsb2, d6tdsc2, d6tdsd1, d6tdsd2
    automated match to d4l29a1
    complexed with cl, edo, na

Details for d6tdsc1

PDB Entry: 6tds (more details), 1.7 Å

PDB Description: crystal structure of the disulfide engineered hla-a0201 molecule without peptide bound after nacl wash
PDB Compounds: (C:) MHC class I antigen

SCOPe Domain Sequences for d6tdsc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tdsc1 d.19.1.1 (C:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgcynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmcaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d6tdsc1:

Click to download the PDB-style file with coordinates for d6tdsc1.
(The format of our PDB-style files is described here.)

Timeline for d6tdsc1: