![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
![]() | Species Human (Homo sapiens), HLA-A2 [TaxId:9606] [54469] (9 PDB entries) |
![]() | Domain d6tdsc1: 6tds C:1-181 [382864] Other proteins in same PDB: d6tdsa2, d6tdsb1, d6tdsb2, d6tdsc2, d6tdsd1, d6tdsd2 automated match to d4l29a1 complexed with cl, edo, na |
PDB Entry: 6tds (more details), 1.7 Å
SCOPe Domain Sequences for d6tdsc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tdsc1 d.19.1.1 (C:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2 [TaxId: 9606]} gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dgetrkvkahsqthrvdlgtlrgcynqseagshtvqrmygcdvgsdwrflrgyhqyaydg kdyialkedlrswtaadmcaqttkhkweaahvaeqlraylegtcvewlrrylengketlq r
Timeline for d6tdsc1: