SCOPe 2.07: Domain d6tdsc1: 6tds C:1-181

Lineage for d6tdsc1 (6tds C:1-181)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-A2 [TaxId:9606] [54469] (9 PDB entries)

8. Domain d6tdsc1: 6tds C:1-181 [382864]
   Other proteins in same PDB: d6tdsa2, d6tdsb1, d6tdsb2, d6tdsc2, d6tdsd1, d6tdsd2
   automated match to d4l29a1
   complexed with cl, edo, na

Details for d6tdsc1

PDB Entry: 6tds, 1.7 Å

PDB Description: crystal structure of the disulfide engineered hla-a0201 molecule without peptide bound after nacl wash

PDB Compounds: (C:) MHC class I antigen

SCOPe Domain Sequences for d6tdsc1:

Sequence; same for both SEQRES and ATOM records:

>d6tdsc1 d.19.1.1 (C:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgcynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmcaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d6tdsc1:

• d6tdsc1 is new in SCOPe 2.07-stable
  
• d6tdsc1 appears in the current release, SCOPe 2.08