SCOPe 2.08: Domain d1efxa2: 1efx A:1-181

Lineage for d1efxa2 (1efx A:1-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-CW3 [TaxId:9606] [54477] (2 PDB entries)

8. Domain d1efxa2: 1efx A:1-181 [38273]
   Other proteins in same PDB: d1efxa1, d1efxb2, d1efxb3, d1efxd1, d1efxd2, d1efxe1, d1efxe2

Details for d1efxa2

PDB Entry: 1efx, 3 Å

PDB Description: structure of a complex between the human natural killer cell receptor kir2dl2 and a class i mhc ligand hla-cw3

PDB Compounds: (A:) hla-cw3 (heavy chain)

SCOPe Domain Sequences for d1efxa2:

Sequence; same for both SEQRES and ATOM records:

>d1efxa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-CW3 [TaxId: 9606]}
gshsmryfytavsrpgrgephfiavgyvddtqfvrfdsdaasprgeprapwveqegpeyw
dretqkykrqaqtdrvslrnlrgyynqseagshiiqrmygcdvgpdgrllrgydqyaydg
kdyialnedlrswtaadtaaqitqrkweaareaeqlrayleglcvewlrrylkngketlq
r

Timeline for d1efxa2:

• d1efxa2 first appeared (with stable ids) in SCOP 1.55
  
• d1efxa2 appears in SCOPe 2.07