SCOPe 2.08: Domain d1efxd1: 1efx D:4-103

Lineage for d1efxd1 (1efx D:4-103)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Killer cell inhibitory receptor [49202] (4 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens), kir2dl3 [TaxId:9606] [49203] (2 PDB entries)

8. Domain d1efxd1: 1efx D:4-103 [21793]
   Other proteins in same PDB: d1efxa1, d1efxa2, d1efxb2, d1efxb3

Details for d1efxd1

PDB Entry: 1efx, 3 Å

PDB Description: structure of a complex between the human natural killer cell receptor kir2dl2 and a class i mhc ligand hla-cw3

PDB Compounds: (D:) natural killer cell receptor kir2dl2

SCOPe Domain Sequences for d1efxd1:

Sequence; same for both SEQRES and ATOM records:

>d1efxd1 b.1.1.4 (D:4-103) Killer cell inhibitory receptor {Human (Homo sapiens), kir2dl3 [TaxId: 9606]}
vhrkpsllahpgrlvkseetvilqcwsdvrfehfllhregkfkdtlhligehhdgvskan
fsigpmmqdlagtyrcygsvthspyqlsapsdpldivitg

Timeline for d1efxd1:

• d1efxd1 first appeared (with stable ids) in SCOP 1.55
  
• d1efxd1 appears in SCOPe 2.07