Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (71 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83331] [315286] (2 PDB entries) |
Domain d6vgkl_: 6vgk L: [382547] automated match to d5e0sh_ |
PDB Entry: 6vgk (more details), 3.1 Å
SCOPe Domain Sequences for d6vgkl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vgkl_ c.14.1.0 (L:) automated matches {Mycobacterium tuberculosis [TaxId: 83331]} sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqplggvtgsaa diaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitr
Timeline for d6vgkl_: