Lineage for d6vgki_ (6vgk I:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2854016Species Mycobacterium tuberculosis [TaxId:83331] [315286] (2 PDB entries)
  8. 2854024Domain d6vgki_: 6vgk I: [382542]
    automated match to d5e0sh_

Details for d6vgki_

PDB Entry: 6vgk (more details), 3.1 Å

PDB Description: clpp1p2 complex from m. tuberculosis
PDB Compounds: (I:) ATP-dependent clp protease proteolytic subunit 1

SCOPe Domain Sequences for d6vgki_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vgki_ c.14.1.0 (I:) automated matches {Mycobacterium tuberculosis [TaxId: 83331]}
sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqplggvtgsaa
diaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitr

SCOPe Domain Coordinates for d6vgki_:

Click to download the PDB-style file with coordinates for d6vgki_.
(The format of our PDB-style files is described here.)

Timeline for d6vgki_: