Class a: All alpha proteins [46456] (290 folds) |
Fold a.103: Citrate synthase [48255] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.103.1: Citrate synthase [48256] (2 families) |
Family a.103.1.0: automated matches [191476] (1 protein) not a true family |
Protein automated matches [190763] (13 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [382276] (1 PDB entry) |
Domain d6k5vd_: 6k5v D: [382361] automated match to d1csca_ complexed with cl |
PDB Entry: 6k5v (more details), 2.69 Å
SCOPe Domain Sequences for d6k5vd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6k5vd_ a.103.1.0 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ldlksqlqelipeqqdrlkklksehgkvqlgnitvdmviggmrgmtgllwetslldpeeg irfrglsipecqkvlptaqsgaeplpegllwllltgkvpskeqvealskdlanraavpdy vynaidalpstahpmtqfasgvmalqvqsefqkayengihkskfweptyedclnliarvp vvaayvyrrmykngdsipsdksldyganfshmlgfddekvkelmrlyitihsdheggnvs ahtghlvgsalsdpylsfaaalnglagplhglanqevllwiksvveecgediskeqlkey vwktlnsgkvipgyghgvlrntdpryvcqrefalkhlpddplfqlvsklyevvppvltel gkvknpwpnvdahsgvllnhygltearyytvlfgvsrslgicsqliwdralglalerpks vtmdwleahc
Timeline for d6k5vd_: