Lineage for d1es0b2 (1es0 B:5-93)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719844Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 719917Species Mouse (Mus musculus), I-A(G7) [TaxId:10090] [88830] (3 PDB entries)
  8. 719918Domain d1es0b2: 1es0 B:5-93 [38218]
    Other proteins in same PDB: d1es0a1, d1es0a2, d1es0b1

Details for d1es0b2

PDB Entry: 1es0 (more details), 2.6 Å

PDB Description: crystal structure of the murine class ii allele i-a(g7) complexed with the glutamic acid decarboxylase (gad65) peptide 207-220
PDB Compounds: (B:) 65 kd glutamic acid decarboxylase+h-2 class II histocompatibility antigen

SCOP Domain Sequences for d1es0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1es0b2 d.19.1.1 (B:5-93) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-A(G7) [TaxId: 10090]}
rhfvhqfkgecyftngtqrirlvtryiynreeylrfdsdvgeyravtelgrhsaeyynkq
ylertraeldtacrhnyeetevptslr

SCOP Domain Coordinates for d1es0b2:

Click to download the PDB-style file with coordinates for d1es0b2.
(The format of our PDB-style files is described here.)

Timeline for d1es0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1es0b1