Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species) |
Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (20 PDB entries) probably orthologous to the human HLA-DQ group |
Domain d1es0a1: 1es0 A:83-180 [21643] Other proteins in same PDB: d1es0a2, d1es0b1, d1es0b2 contains covalently bound peptides |
PDB Entry: 1es0 (more details), 2.6 Å
SCOP Domain Sequences for d1es0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1es0a1 b.1.1.2 (A:83-180) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrd hsfhklsyltfipsdddiydckvehwgleepvlkhwss
Timeline for d1es0a1: