Lineage for d6ra6a1 (6ra6 A:1-147)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688341Protein Neuroglobin [100978] (2 species)
  7. 2688349Species Mouse (Mus musculus) [TaxId:10090] [109625] (38 PDB entries)
    Uniprot Q9ER97
  8. 2688378Domain d6ra6a1: 6ra6 A:1-147 [382170]
    Other proteins in same PDB: d6ra6a2
    automated match to d1hbrd_
    complexed with gol, hem, peg, so4, trs; mutant

Details for d6ra6a1

PDB Entry: 6ra6 (more details), 2.3 Å

PDB Description: ferric murine neuroglobin gly-loop44-47/f106a mutant
PDB Compounds: (A:) Neuroglobin,Murine neuroglobin mutant,Neuroglobin

SCOPe Domain Sequences for d6ra6a1:

Sequence, based on SEQRES records: (download)

>d6ra6a1 a.1.1.2 (A:1-147) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]}
merpeselirqswrvvsrsplehgtvlfarlfalepsllplfqgggqfsspedslsspef
ldhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssastvgesllymleksl
gpdftpatrtawsrlygavvqamsrgw

Sequence, based on observed residues (ATOM records): (download)

>d6ra6a1 a.1.1.2 (A:1-147) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]}
merpeselirqswrvvsrsplehgtvlfarlfalepsllplfqgggqfssspefldhirk
vmlvidaavtnvedlssleeyltslgrkhravgvrlssastvgesllymlekslgpdftp
atrtawsrlygavvqamsrgw

SCOPe Domain Coordinates for d6ra6a1:

Click to download the PDB-style file with coordinates for d6ra6a1.
(The format of our PDB-style files is described here.)

Timeline for d6ra6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ra6a2