SCOP 1.73: Domain d1a6ab2: 1a6a B:5-92

Lineage for d1a6ab2 (1a6a B:5-92)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Human (Homo sapiens), HLA-DR3 [TaxId:9606] [88823] (1 PDB entry)

8. Domain d1a6ab2: 1a6a B:5-92 [38190]
   Other proteins in same PDB: d1a6aa1, d1a6aa2, d1a6ab1
   complexed with nag

Details for d1a6ab2

PDB Entry: 1a6a, 2.75 Å

PDB Description: the structure of an intermediate in class ii mhc maturation: clip bound to hla-dr3

PDB Compounds: (B:) hla class II histocompatibility antigen, dr-1 beta chain

SCOP Domain Sequences for d1a6ab2:

Sequence; same for both SEQRES and ATOM records:

>d1a6ab2 d.19.1.1 (B:5-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR3 [TaxId: 9606]}
prfleystsechffngtervryldryfhnqeenvrfdsdvgefravtelgrpdaeywnsq
kdlleqkrgrvdnycrhnygvvesftvq

Timeline for d1a6ab2:

• d1a6ab2 first appeared (with stable ids) in SCOP 1.55
  
• d1a6ab2 appears in SCOP 1.71
  
• d1a6ab2 appears in SCOP 1.75
  
• d1a6ab2 appears in the current release, SCOPe 2.08