Lineage for d1a6ab2 (1a6a B:5-92)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938367Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2938431Species Human (Homo sapiens), HLA-DR3 [TaxId:9606] [88823] (1 PDB entry)
  8. 2938432Domain d1a6ab2: 1a6a B:5-92 [38190]
    Other proteins in same PDB: d1a6aa1, d1a6aa2, d1a6ab1
    complexed with nag
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1a6ab2

PDB Entry: 1a6a (more details), 2.75 Å

PDB Description: the structure of an intermediate in class ii mhc maturation: clip bound to hla-dr3
PDB Compounds: (B:) hla class II histocompatibility antigen, dr-1 beta chain

SCOPe Domain Sequences for d1a6ab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6ab2 d.19.1.1 (B:5-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR3 [TaxId: 9606]}
prfleystsechffngtervryldryfhnqeenvrfdsdvgefravtelgrpdaeywnsq
kdlleqkrgrvdnycrhnygvvesftvq

SCOPe Domain Coordinates for d1a6ab2:

Click to download the PDB-style file with coordinates for d1a6ab2.
(The format of our PDB-style files is described here.)

Timeline for d1a6ab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a6ab1