![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.5: Barrier-to-autointegration factor, BAF [47798] (1 family) ![]() contains one classic and one pseudo HhH motifs automatically mapped to Pfam PF02961 |
![]() | Family a.60.5.1: Barrier-to-autointegration factor, BAF [47799] (2 proteins) |
![]() | Protein automated matches [381829] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [381830] (1 PDB entry) |
![]() | Domain d6rpre_: 6rpr E: [381831] Other proteins in same PDB: d6rprb_, d6rprg_ automated match to d1ci4a_ protein/DNA complex; complexed with so4; mutant |
PDB Entry: 6rpr (more details), 2.26 Å
SCOPe Domain Sequences for d6rpre_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rpre_ a.60.5.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfrew lkdtaganakqsrdafgalrewadafl
Timeline for d6rpre_: