Lineage for d6rpre_ (6rpr E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715850Superfamily a.60.5: Barrier-to-autointegration factor, BAF [47798] (1 family) (S)
    contains one classic and one pseudo HhH motifs
    automatically mapped to Pfam PF02961
  5. 2715851Family a.60.5.1: Barrier-to-autointegration factor, BAF [47799] (2 proteins)
  6. 2715902Protein automated matches [381829] (1 species)
    not a true protein
  7. 2715903Species Human (Homo sapiens) [TaxId:9606] [381830] (1 PDB entry)
  8. 2715905Domain d6rpre_: 6rpr E: [381831]
    Other proteins in same PDB: d6rprb_, d6rprg_
    automated match to d1ci4a_
    protein/DNA complex; complexed with so4; mutant

Details for d6rpre_

PDB Entry: 6rpr (more details), 2.26 Å

PDB Description: lem domain of emerin mutant t43i in complex with baf dimer and the igfold of the lamin a/c
PDB Compounds: (E:) barrier to autointegration factor (BAF)

SCOPe Domain Sequences for d6rpre_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rpre_ a.60.5.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfrew
lkdtaganakqsrdafgalrewadafl

SCOPe Domain Coordinates for d6rpre_:

Click to download the PDB-style file with coordinates for d6rpre_.
(The format of our PDB-style files is described here.)

Timeline for d6rpre_: