SCOPe 2.08: Domain d1fv1d2: 1fv1 D:4-81

Lineage for d1fv1d2 (1fv1 D:4-81)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88809] (13 PDB entries)

8. Domain d1fv1d2: 1fv1 D:4-81 [38181]
   Other proteins in same PDB: d1fv1a1, d1fv1b1, d1fv1b2, d1fv1d1, d1fv1e1, d1fv1e2
   complexed with gol, so4
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1fv1d2

PDB Entry: 1fv1, 1.9 Å

PDB Description: structural basis for the binding of an immunodominant peptide from myelin basic protein in different registers by two hla-dr2 alleles

PDB Compounds: (D:) major histocompatibility complex alpha chain

SCOPe Domain Sequences for d1fv1d2:

Sequence; same for both SEQRES and ATOM records:

>d1fv1d2 d.19.1.1 (D:4-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp

Timeline for d1fv1d2:

• d1fv1d2 first appeared (with stable ids) in SCOP 1.55
  
• d1fv1d2 appears in SCOPe 2.07