| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species) |
| Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries) Uniprot P01903 28-207 probably orthologous to the mouse I-E group |
| Domain d1fv1a1: 1fv1 A:82-181 [21605] Other proteins in same PDB: d1fv1a2, d1fv1b1, d1fv1b2, d1fv1d2, d1fv1e1, d1fv1e2 complexed with gol, so4 |
PDB Entry: 1fv1 (more details), 1.9 Å
SCOPe Domain Sequences for d1fv1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fv1a1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd
Timeline for d1fv1a1: