SCOPe 2.08: Domain d1fv1a1: 1fv1 A:82-181

Lineage for d1fv1a1 (1fv1 A:82-181)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries)
   Uniprot P01903 28-207
   probably orthologous to the mouse I-E group

8. Domain d1fv1a1: 1fv1 A:82-181 [21605]
   Other proteins in same PDB: d1fv1a2, d1fv1b1, d1fv1b2, d1fv1d2, d1fv1e1, d1fv1e2
   complexed with gol, so4

Details for d1fv1a1

PDB Entry: 1fv1, 1.9 Å

PDB Description: structural basis for the binding of an immunodominant peptide from myelin basic protein in different registers by two hla-dr2 alleles

PDB Compounds: (A:) major histocompatibility complex alpha chain

SCOPe Domain Sequences for d1fv1a1:

Sequence; same for both SEQRES and ATOM records:

>d1fv1a1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

Timeline for d1fv1a1:

• d1fv1a1 first appeared (with stable ids) in SCOP 1.55
  
• d1fv1a1 appears in SCOPe 2.07