SCOPe 2.08: Domain d6ntca1: 6ntc A:1-166

Lineage for d6ntca1 (6ntc A:1-166)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)

8. Domain d6ntca1: 6ntc A:1-166 [381715]
   Other proteins in same PDB: d6ntca2, d6ntcb_
   automated match to d3l0ib_
   complexed with gnp, gol, mg

Details for d6ntca1

PDB Entry: 6ntc, 2.9 Å

PDB Description: crystal structure of g12v hras-gppnhp bound in complex with the engineered rbd variant 1 of craf kinase protein

PDB Compounds: (A:) gtpase hras

SCOPe Domain Sequences for d6ntca1:

Sequence; same for both SEQRES and ATOM records:

>d6ntca1 c.37.1.0 (A:1-166) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Timeline for d6ntca1:

• d6ntca1 first appeared in SCOPe 2.07