SCOPe 2.08: Domain d6ntcb_: 6ntc B:

Lineage for d6ntcb_ (6ntc B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins)
   contains Pfam PF00788 and Pfam PF02196

6. Protein c-Raf1 RBD [54264] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54265] (8 PDB entries)

8. Domain d6ntcb_: 6ntc B: [381723]
   Other proteins in same PDB: d6ntca1, d6ntca2
   automated match to d4g0nb_
   complexed with gnp, gol, mg

Details for d6ntcb_

PDB Entry: 6ntc, 2.9 Å

PDB Description: crystal structure of g12v hras-gppnhp bound in complex with the engineered rbd variant 1 of craf kinase protein

PDB Compounds: (B:) raf proto-oncogene serine/threonine-protein kinase

SCOPe Domain Sequences for d6ntcb_:

Sequence, based on SEQRES records:

>d6ntcb_ d.15.1.5 (B:) c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]}
ntirvllpnqewtvvkvrngmslhdslmkalkrhglqpessavfrllhehkgkkarldwn
tdaasligeelqvdf

Sequence, based on observed residues (ATOM records):

>d6ntcb_ d.15.1.5 (B:) c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]}
ntirvllpnqewtvvkvmslhdslmkalkrhglqpessavfkarldwntdaasligeelq
vdf

Timeline for d6ntcb_:

• d6ntcb_ first appeared in SCOPe 2.07