Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) |
Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
Protein automated matches [226938] (26 species) not a true protein |
Species Trypanosoma cruzi [TaxId:353153] [226636] (7 PDB entries) |
Domain d6jl6f1: 6jl6 F:1-157 [381646] Other proteins in same PDB: d6jl6a3, d6jl6b3, d6jl6d3, d6jl6e3, d6jl6f3 automated match to d4iv5d1 complexed with asp, po4 |
PDB Entry: 6jl6 (more details), 2 Å
SCOPe Domain Sequences for d6jl6f1:
Sequence, based on SEQRES records: (download)
>d6jl6f1 c.78.1.0 (F:1-157) automated matches {Trypanosoma cruzi [TaxId: 353153]} mlelppvaslkgksitsaeqfsradiyalihlasamqrkidagevlnllqgrimtplffe dssrtfssfcaamirlggsvvnfkveassinkgetladtirtldsysdvlvmrhprqdai eealsvaqhpilnagngagehptqalldtltihselg
>d6jl6f1 c.78.1.0 (F:1-157) automated matches {Trypanosoma cruzi [TaxId: 353153]} mlelppvaslkgksitsaeqfsradiyalihlasamqrkidagevlnllqgrimtplffe dssrtfssfcaamirlggsvvnfkvegetladtirtldsysdvlvmrhprqdaieealsv aqhpilnagngagehptqalldtltihselg
Timeline for d6jl6f1: