Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) |
Family d.130.1.0: automated matches [254267] (1 protein) not a true family |
Protein automated matches [254617] (15 species) not a true protein |
Species Medicago truncatula [TaxId:3880] [381575] (1 PDB entry) |
Domain d6vcwa3: 6vcw A:240-389 [381578] automated match to d2hj2a3 complexed with cl, edo, mg |
PDB Entry: 6vcw (more details), 1.4 Å
SCOPe Domain Sequences for d6vcwa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vcwa3 d.130.1.0 (A:240-389) automated matches {Medicago truncatula [TaxId: 3880]} iggphgdagltgrkiiidtyggwgahgggafsgkdptkvdrsgayivrqaaksvvasgla rrcivqvsyaigvpeplsvfvdtyktgkipdkdilvlikehfdfrpgmisnnldlkrggn fryqktaayghfgrddpdftwetvkilkpk
Timeline for d6vcwa3: