Lineage for d6vcwa3 (6vcw A:240-389)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2582825Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2582826Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2582960Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2582961Protein automated matches [254617] (15 species)
    not a true protein
  7. 2583215Species Medicago truncatula [TaxId:3880] [381575] (1 PDB entry)
  8. 2583218Domain d6vcwa3: 6vcw A:240-389 [381578]
    automated match to d2hj2a3
    complexed with cl, edo, mg

Details for d6vcwa3

PDB Entry: 6vcw (more details), 1.4 Å

PDB Description: crystal structure of medicago truncatula s-adenosylmethionine synthase 3a (mtmat3a)
PDB Compounds: (A:) S-adenosylmethionine synthase

SCOPe Domain Sequences for d6vcwa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vcwa3 d.130.1.0 (A:240-389) automated matches {Medicago truncatula [TaxId: 3880]}
iggphgdagltgrkiiidtyggwgahgggafsgkdptkvdrsgayivrqaaksvvasgla
rrcivqvsyaigvpeplsvfvdtyktgkipdkdilvlikehfdfrpgmisnnldlkrggn
fryqktaayghfgrddpdftwetvkilkpk

SCOPe Domain Coordinates for d6vcwa3:

Click to download the PDB-style file with coordinates for d6vcwa3.
(The format of our PDB-style files is described here.)

Timeline for d6vcwa3: