SCOPe 2.07: Domain d6vcwa2: 6vcw A:113-239

Lineage for d6vcwa2 (6vcw A:113-239)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
   duplication: consists of 3 similar intertwined domains
   structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta

4. Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families)

5. Family d.130.1.0: automated matches [254267] (1 protein)
   not a true family

6. Protein automated matches [254617] (15 species)
   not a true protein

7. Species Medicago truncatula [TaxId:3880] [381575] (1 PDB entry)

8. Domain d6vcwa2: 6vcw A:113-239 [381577]
   automated match to d2hj2a2
   complexed with cl, edo, mg

Details for d6vcwa2

PDB Entry: 6vcw, 1.4 Å

PDB Description: crystal structure of medicago truncatula s-adenosylmethionine synthase 3a (mtmat3a)

PDB Compounds: (A:) S-adenosylmethionine synthase

SCOPe Domain Sequences for d6vcwa2:

Sequence; same for both SEQRES and ATOM records:

>d6vcwa2 d.130.1.0 (A:113-239) automated matches {Medicago truncatula [TaxId: 3880]}
kkpeeigagdqghmfgyatdetpelmplthvlatklgakltevrknktcawlrpdgktqv
tveyqndngamvpirvhtvlistqhdetvtnekiaadlkehvikpvipakylddktifhl
npsgrfv

Timeline for d6vcwa2:

• d6vcwa2 is new in SCOPe 2.07-stable
  
• d6vcwa2 appears in the current release, SCOPe 2.08