SCOPe 2.07: Domain d6vcza3: 6vcz A:240-389

Lineage for d6vcza3 (6vcz A:240-389)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
   duplication: consists of 3 similar intertwined domains
   structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta

4. Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families)

5. Family d.130.1.0: automated matches [254267] (1 protein)
   not a true family

6. Protein automated matches [254617] (15 species)
   not a true protein

7. Species Arabidopsis thaliana [TaxId:3702] [381544] (6 PDB entries)

8. Domain d6vcza3: 6vcz A:240-389 [381547]
   automated match to d1mxaa3
   complexed with mg, mpo, mxe, pge, pgr, po4

Details for d6vcza3

PDB Entry: 6vcz, 1.52 Å

PDB Description: crystal structure of arabidopsis thaliana s-adenosylmethionine synthase 2 (atmat2)

PDB Compounds: (A:) S-adenosylmethionine synthase 2

SCOPe Domain Sequences for d6vcza3:

Sequence; same for both SEQRES and ATOM records:

>d6vcza3 d.130.1.0 (A:240-389) automated matches {Arabidopsis thaliana [TaxId: 3702]}
iggphgdagltgrkiiidtyggwgahgggafsgkdptkvdrsgayivrqaaksvvangma
rralvqvsyaigvpeplsvfvdtygtglipdkeilkivketfdfrpgmmtinldlkrggn
grfqktaayghfgrddpdftwevvkplkwd

Timeline for d6vcza3:

• d6vcza3 is new in SCOPe 2.07-stable
  
• d6vcza3 appears in the current release, SCOPe 2.08