Lineage for d6vcza1 (6vcz A:1-101)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2582825Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2582826Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2582960Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2582961Protein automated matches [254617] (15 species)
    not a true protein
  7. 2582962Species Arabidopsis thaliana [TaxId:3702] [381544] (6 PDB entries)
  8. 2582972Domain d6vcza1: 6vcz A:1-101 [381545]
    automated match to d1mxaa1
    complexed with mg, mpo, mxe, pge, pgr, po4

Details for d6vcza1

PDB Entry: 6vcz (more details), 1.52 Å

PDB Description: crystal structure of arabidopsis thaliana s-adenosylmethionine synthase 2 (atmat2)
PDB Compounds: (A:) S-adenosylmethionine synthase 2

SCOPe Domain Sequences for d6vcza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vcza1 d.130.1.0 (A:1-101) automated matches {Arabidopsis thaliana [TaxId: 3702]}
metflftsesvneghpdklcdqisdavldacleqdpdskvacetctktnmvmvfgeittk
atidyekivrdtcrsigfisddvgldadkckvlvnieqqsp

SCOPe Domain Coordinates for d6vcza1:

Click to download the PDB-style file with coordinates for d6vcza1.
(The format of our PDB-style files is described here.)

Timeline for d6vcza1: