SCOPe 2.07: Domain d6pucd1: 6puc D:2-110

Lineage for d6pucd1 (6puc D:2-110)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6pucd1: 6puc D:2-110 [381043]
   Other proteins in same PDB: d6puca1, d6puca3, d6pucb1, d6pucb2, d6pucc1, d6pucc3, d6pucd2, d6pucf1, d6pucf2, d6pucg2
   automated match to d2f54d1
   complexed with cl, gol, na, q87

Details for d6pucd1

PDB Entry: 6puc, 1.85 Å

PDB Description: structure of human mait a-f7 tcr in complex with human mr1-5-op-ru

PDB Compounds: (D:) Human TCR alpha chain

SCOPe Domain Sequences for d6pucd1:

Sequence; same for both SEQRES and ATOM records:

>d6pucd1 b.1.1.0 (D:2-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrfs
sflsrskgysylllkelqmkdsasylcavkdsnyqliwgagtkliikpd

Timeline for d6pucd1:

• d6pucd1 is new in SCOPe 2.07-stable
  
• d6pucd1 appears in the current release, SCOPe 2.08