Lineage for d6puca1 (6puc A:1-178)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2545715Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2545716Protein automated matches [226842] (5 species)
    not a true protein
  7. 2545737Species Human (Homo sapiens) [TaxId:9606] [226044] (102 PDB entries)
  8. 2545770Domain d6puca1: 6puc A:1-178 [380929]
    Other proteins in same PDB: d6puca2, d6puca3, d6pucb1, d6pucb2, d6pucc2, d6pucc3, d6pucd1, d6pucd2, d6puce1, d6puce2, d6pucf1, d6pucf2, d6pucg1, d6pucg2, d6puch1, d6puch2
    automated match to d4l4va1
    complexed with cl, gol, na, q87

Details for d6puca1

PDB Entry: 6puc (more details), 1.85 Å

PDB Description: structure of human mait a-f7 tcr in complex with human mr1-5-op-ru
PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d6puca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6puca1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

SCOPe Domain Coordinates for d6puca1:

Click to download the PDB-style file with coordinates for d6puca1.
(The format of our PDB-style files is described here.)

Timeline for d6puca1: