Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (102 PDB entries) |
Domain d6puca1: 6puc A:1-178 [380929] Other proteins in same PDB: d6puca2, d6puca3, d6pucb1, d6pucb2, d6pucc2, d6pucc3, d6pucd1, d6pucd2, d6puce1, d6puce2, d6pucf1, d6pucf2, d6pucg1, d6pucg2, d6puch1, d6puch2 automated match to d4l4va1 complexed with cl, gol, na, q87 |
PDB Entry: 6puc (more details), 1.85 Å
SCOPe Domain Sequences for d6puca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6puca1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]} rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr
Timeline for d6puca1: