SCOPe 2.08: Domain d6rgya1: 6rgy A:243-320

Lineage for d6rgya1 (6rgy A:243-320)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.30: ROP-like [47379] (8 superfamilies)
   4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist

4. Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families)

5. Family a.30.2.0: automated matches [227712] (1 protein)
   not a true family

6. Protein automated matches [227713] (2 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [227714] (7 PDB entries)

8. Domain d6rgya1: 6rgy A:243-320 [380989]
   Other proteins in same PDB: d6rgya2, d6rgyb2, d6rgyc_, d6rgyd_
   automated match to d2c2aa1
   complexed with adp, cit, mg, so4

Details for d6rgya1

PDB Entry: 6rgy, 2.2 Å

PDB Description: revisiting ph-gated conformational switch. complex hk853-rr468 ph 7.5

PDB Compounds: (A:) Osmosensitive K+ channel histidine kinase KdpD

SCOPe Domain Sequences for d6rgya1:

Sequence; same for both SEQRES and ATOM records:

>d6rgya1 a.30.2.0 (A:243-320) automated matches {Thermotoga maritima [TaxId: 243274]}
rlkridrmktefianishelrtpltaikayaetiynslgeldlstlkefleviidqsnhl
enllnelldfsrlerksl

Timeline for d6rgya1:

• d6rgya1 first appeared in SCOPe 2.07