Lineage for d1ar0a_ (1ar0 A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 131584Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 131706Superfamily d.17.4: NTF2-like [54427] (4 families) (S)
  5. 131727Family d.17.4.2: NTF2-like [54431] (3 proteins)
  6. 131736Protein Nuclear transport factor-2 (NTF2) [54432] (1 species)
  7. 131737Species Rat (Rattus norvegicus) [TaxId:10116] [54433] (5 PDB entries)
  8. 131740Domain d1ar0a_: 1ar0 A: [38092]

Details for d1ar0a_

PDB Entry: 1ar0 (more details), 2.3 Å

PDB Description: nuclear transport factor 2 (ntf2) e42k mutant

SCOP Domain Sequences for d1ar0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ar0a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus)}
gdkpiweqigssfiqhyyqlfdndrtqlgaiyidascltwkgqqfqgkaaiveklsslpf
qkiqhsitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfrl
alhnf

SCOP Domain Coordinates for d1ar0a_:

Click to download the PDB-style file with coordinates for d1ar0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ar0a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ar0b_