| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.2: NTF2-like [54431] (6 proteins) |
| Protein Nuclear transport factor-2 (NTF2) [54432] (4 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [54433] (11 PDB entries) Uniprot P61972 |
| Domain d1ar0a_: 1ar0 A: [38092] mutant |
PDB Entry: 1ar0 (more details), 2.3 Å
SCOPe Domain Sequences for d1ar0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ar0a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gdkpiweqigssfiqhyyqlfdndrtqlgaiyidascltwkgqqfqgkaaiveklsslpf
qkiqhsitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfrl
alhnf
Timeline for d1ar0a_: