| Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
| Fold d.17: Cystatin-like [54402] (5 superfamilies) |
Superfamily d.17.4: NTF2-like [54427] (4 families) ![]() |
| Family d.17.4.2: NTF2-like [54431] (3 proteins) |
| Protein Nuclear transport factor-2 (NTF2) [54432] (1 species) |
| Species Rat (Rattus norvegicus) [TaxId:10116] [54433] (5 PDB entries) |
| Domain d1ounb_: 1oun B: [38091] |
PDB Entry: 1oun (more details), 2.3 Å
SCOP Domain Sequences for d1ounb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ounb_ d.17.4.2 (B:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus)}
kpiweqigssfiqhyyqlfdndrtqlgaiyidascltwegqqfqgkaaiveklsslpfqk
iqhsitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfrlal
h
Timeline for d1ounb_: