Lineage for d1ounb_ (1oun B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.17: Cystatin-like [54402] (5 superfamilies) Superfamily d.17.4: NTF2-like [54427] (4 families) 
Family d.17.4.2: Nuclear transport factor-2 (NTF2) [54431] (1 protein) Protein Nuclear transport factor-2 (NTF2) [54432] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [54433] (5 PDB entries) 
Domain d1ounb_: 1oun B: [38091]
Details for d1ounb_
PDB Entry: 1oun (more details), 2.3 Å
PDB Description: crystal structure of nuclear transport factor 2 (ntf2)
SCOP Domain Sequences for d1ounb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ounb_ d.17.4.2 (B:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus)}
kpiweqigssfiqhyyqlfdndrtqlgaiyidascltwegqqfqgkaaiveklsslpfqk
iqhsitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfrlal
h
SCOP Domain Coordinates for d1ounb_:
Click to download the PDB-style file with coordinates for d1ounb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ounb_:
- d1ounb_ appears in SCOP 1.57
- d1ounb_ appears in the current release, SCOPe 2.08
View in 3D
