Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) |
Family c.1.1.0: automated matches [191424] (1 protein) not a true family |
Protein automated matches [190605] (25 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [268515] (8 PDB entries) |
Domain d6nxya_: 6nxy A: [380778] automated match to d1tmha_ complexed with na; mutant |
PDB Entry: 6nxy (more details), 1.05 Å
SCOPe Domain Sequences for d6nxya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nxya_ c.1.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} markffvggnwkcngtaeevkkivntlneaqvpsqdvvevvvsppyvflplvkstlrsdf fvaaqncwvkkggaftgevsaemlvnldipwvilghserrailnessefvgdkvayalaq glkviacvgetleereagstmdvvaaqtkaiadrvtnwsnvviayepvwaigtgkvaspa qaqevhdelrkwlaknvsadvaattriiyggsvnggndkelggqadvdgflvggaslkpe fidiikaaevk
Timeline for d6nxya_: