SCOPe 2.08: Domain d6p3yb2: 6p3y B:196-383

Lineage for d6p3yb2 (6p3y B:196-383)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.6: apolipoprotein B messenger RNA-editing enzyme catalytic (APOBEC) cytidine deaminase domains [310632] (5 proteins)
   strand 5 is parallel to strand 4
   Pfam PF08210; Pfam PF05240

6. Protein APOBEC3G (ARCD) [310757] (2 species)

7. Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [346337] (6 PDB entries)

8. Domain d6p3yb2: 6p3y B:196-383 [380445]
   automated match to d5k82a_
   complexed with zn

Details for d6p3yb2

PDB Entry: 6p3y, 2.57 Å

PDB Description: crystal structure of full length apobec3g e/q (ph 7.4)

PDB Compounds: (B:) Apolipoprotein B mRNA editing enzyme, catalytic peptide-like 3G

SCOPe Domain Sequences for d6p3yb2:

Sequence, based on SEQRES records:

>d6p3yb2 c.97.1.6 (B:196-383) APOBEC3G (ARCD) {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
lmdpgtftsnfnnkpwvsgqhetylcykverlhndtwvplnqhrgflrnqapnihgfpkg
rhaqlcfldlipfwkldgqqyrvtcftswspcfscaqemakfisnnehvslcifaariyd
dqgryqeglrtlhrdgakiammnysefeycwdtfvdrqgrpfqpwdgldehsqalsgrlr
ailqnqgn

Sequence, based on observed residues (ATOM records):

>d6p3yb2 c.97.1.6 (B:196-383) APOBEC3G (ARCD) {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
lmdpgtftsnfnnkpwvsgqhetylcykverlhndtwvplnqhrgflrnqlcfldlipfw
kldgqqyrvtcftswspcfscaqemakfisnnehvslcifaariyddqgryqeglrtlhr
dgakiammnysefeycwdtfvdrqgrpfqpwdgldehsqalsgrlrailqnqgn

Timeline for d6p3yb2:

• d6p3yb2 first appeared in SCOPe 2.07