Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
Superfamily d.167.1: Peptide deformylase [56420] (2 families) nickel-dependent enzyme |
Family d.167.1.0: automated matches [191587] (1 protein) not a true family |
Protein automated matches [191055] (20 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [380338] (6 PDB entries) |
Domain d6jfdd_: 6jfd D: [380414] automated match to d5kobc_ complexed with k1u, ni |
PDB Entry: 6jfd (more details), 2.4 Å
SCOPe Domain Sequences for d6jfdd_:
Sequence, based on SEQRES records: (download)
>d6jfdd_ d.167.1.0 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} ireilkmgderllriaqpvpsellgseelqrliddmfetmhhvggvglaapqigvdlqlv ifgferserypdapavpptillnpritplddemeegwegclsvpglrgavsrhrriryqg ldpqgqpidrsvegfharvvqhecdhligrlypsritdfskfgftevl
>d6jfdd_ d.167.1.0 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} ireilkmgderllriaqpvpsellgseelqrliddmfetmhhvggvglaapqigvdlqlv ifgfepavpptillnpritplddemeegwegclsvpglrgavsrhrriryqgldpqgqpi drsvegfharvvqhecdhligrlypsritdfskfgftevl
Timeline for d6jfdd_: