Lineage for d6jfdd_ (6jfd D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606866Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 2606867Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 2607053Family d.167.1.0: automated matches [191587] (1 protein)
    not a true family
  6. 2607054Protein automated matches [191055] (20 species)
    not a true protein
  7. 2607122Species Pseudomonas aeruginosa [TaxId:287] [380338] (6 PDB entries)
  8. 2607136Domain d6jfdd_: 6jfd D: [380414]
    automated match to d5kobc_
    complexed with k1u, ni

Details for d6jfdd_

PDB Entry: 6jfd (more details), 2.4 Å

PDB Description: k1u bound crystal structure of class i type b peptide deformylase from pseudomonas aeruginosa
PDB Compounds: (D:) Peptide deformylase

SCOPe Domain Sequences for d6jfdd_:

Sequence, based on SEQRES records: (download)

>d6jfdd_ d.167.1.0 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
ireilkmgderllriaqpvpsellgseelqrliddmfetmhhvggvglaapqigvdlqlv
ifgferserypdapavpptillnpritplddemeegwegclsvpglrgavsrhrriryqg
ldpqgqpidrsvegfharvvqhecdhligrlypsritdfskfgftevl

Sequence, based on observed residues (ATOM records): (download)

>d6jfdd_ d.167.1.0 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
ireilkmgderllriaqpvpsellgseelqrliddmfetmhhvggvglaapqigvdlqlv
ifgfepavpptillnpritplddemeegwegclsvpglrgavsrhrriryqgldpqgqpi
drsvegfharvvqhecdhligrlypsritdfskfgftevl

SCOPe Domain Coordinates for d6jfdd_:

Click to download the PDB-style file with coordinates for d6jfdd_.
(The format of our PDB-style files is described here.)

Timeline for d6jfdd_: