Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
Superfamily d.167.1: Peptide deformylase [56420] (2 families) nickel-dependent enzyme |
Family d.167.1.0: automated matches [191587] (1 protein) not a true family |
Protein automated matches [191055] (20 species) not a true protein |
Species Burkholderia xenovorans [TaxId:266265] [319599] (1 PDB entry) |
Domain d5kobc_: 5kob C: [319615] Other proteins in same PDB: d5koba2 automated match to d3dlda_ complexed with edo, fe2, fmt |
PDB Entry: 5kob (more details), 1.6 Å
SCOPe Domain Sequences for d5kobc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kobc_ d.167.1.0 (C:) automated matches {Burkholderia xenovorans [TaxId: 266265]} ireilkmgdprllriadpvdhfdtpelhelvkdmfetmhdangaglaapqigvnlqvvif gfghnerypdappvpetvlinptitpvsqdmeegwegclsvpglrgavsrfsmikyhgfd qygkpidrvaegfharvvqhecdhligklypmrindfakfgftevlfpdm
Timeline for d5kobc_:
View in 3D Domains from other chains: (mouse over for more information) d5koba1, d5koba2, d5kobb_, d5kobd_ |