Lineage for d5kobc_ (5kob C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606866Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 2606867Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 2607053Family d.167.1.0: automated matches [191587] (1 protein)
    not a true family
  6. 2607054Protein automated matches [191055] (20 species)
    not a true protein
  7. 2607081Species Burkholderia xenovorans [TaxId:266265] [319599] (1 PDB entry)
  8. 2607084Domain d5kobc_: 5kob C: [319615]
    Other proteins in same PDB: d5koba2
    automated match to d3dlda_
    complexed with edo, fe2, fmt

Details for d5kobc_

PDB Entry: 5kob (more details), 1.6 Å

PDB Description: crystal structure of a peptide deformylase from burkholderia xenovorans
PDB Compounds: (C:) Peptide deformylase

SCOPe Domain Sequences for d5kobc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kobc_ d.167.1.0 (C:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
ireilkmgdprllriadpvdhfdtpelhelvkdmfetmhdangaglaapqigvnlqvvif
gfghnerypdappvpetvlinptitpvsqdmeegwegclsvpglrgavsrfsmikyhgfd
qygkpidrvaegfharvvqhecdhligklypmrindfakfgftevlfpdm

SCOPe Domain Coordinates for d5kobc_:

Click to download the PDB-style file with coordinates for d5kobc_.
(The format of our PDB-style files is described here.)

Timeline for d5kobc_: