Lineage for d6jf8a_ (6jf8 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606866Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 2606867Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 2607053Family d.167.1.0: automated matches [191587] (1 protein)
    not a true family
  6. 2607054Protein automated matches [191055] (20 species)
    not a true protein
  7. 2607055Species Acinetobacter baumannii [TaxId:470] [380329] (6 PDB entries)
  8. 2607056Domain d6jf8a_: 6jf8 A: [380402]
    automated match to d2defa_
    complexed with lhy, zn

Details for d6jf8a_

PDB Entry: 6jf8 (more details), 1.7 Å

PDB Description: k4u bound crystal structure of class i type b peptide deformylase from acinetobacter baumannii
PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d6jf8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jf8a_ d.167.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
svvlpvakrgedilkliaapvsanelnsnwlyqladamhatmlerngvgiaapqvyiskr
viivasrpnprypdapemnavvmvnpeilefssemclgeegclsvpdergqveraemvkv
kyltlqgemvetvfqgfparivqhevdhlngilfveris

SCOPe Domain Coordinates for d6jf8a_:

Click to download the PDB-style file with coordinates for d6jf8a_.
(The format of our PDB-style files is described here.)

Timeline for d6jf8a_: